PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g017980.1
Common NameMTR_5g017980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 327aa    MW: 36628.1 Da    PI: 6.5166
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g017980.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32193248156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W++eLH+rFv+a++qLGG++ AtPk+i+e m+v+gLt+++vkSHLQkYRl+
  Medtr5g017980.1 193 KQRRCWSSELHRRFVDALQQLGGAHAATPKQIREKMQVDGLTNDEVKSHLQKYRLH 248
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.752190250IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-29190251IPR009057Homeodomain-like
SuperFamilySSF466895.73E-17191251IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-27193248IPR006447Myb domain, plants
PfamPF002492.6E-7195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEQQQQLNLD LTLASVPKTV SHFLNNVVQT KDMSQKLSML DDLVHSLEEE MKKVLAFKRE  60
LPLSILLLND AIARLNDEKE KVRLMKMDDL KENCDNKKNW MSSAQLWTNE TKSKNEGDDD  120
RTVLHKGNGG EVFMGFTENL LKEVSQAKSF SLVSEVSHGN SKSGGGSSGS SLLRVEIQNQ  180
PQPPQPLQQS SRKQRRCWSS ELHRRFVDAL QQLGGAHAAT PKQIREKMQV DGLTNDEVKS  240
HLQKYRLHVR RFPVSSIQEA NKLALYMAHD QCEEDTSEGN FSESVSPQGP LTPLLLGGSA  300
QGLSSHGRNS MDAEDEQSDC RNWKSD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.136180.0flower| glandular trichome| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0135151e-175CU013515.2 Medicago truncatula chromosome 5 clone mth2-106f22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611799.10.0myb-like DNA-binding domain, shaqkyf class protein
TrEMBLG7K8320.0G7K832_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA01G39040.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.19e-58G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]